<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-9230 9230-30915 Brazil 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I84V, N88S   L10I, I13V, L19V, K20I, E35ED, N37S, L63P, I66IV, A71T, I72IT, I85IV, I93L  
>9230-30915| codons 4-99
TLWQRPIVTVKIGGQVIEALLDTGADDTVLEDMSLPGRWKPKIIGGIGGFIKVRQYDQIP
IEVCGHKTTGTVLVGPTPVNVVGRSLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, L74I, M184V, T215F V75A, K219E K103N   K64H, V118VI, K122E, I142T, T200A, Q207G, R211RK, D218E, L228LF, V245EK  
>9230-30915| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFAIHKKNSTRWRKIADFRELNKRTQDFWEVQLGIPHP
AGLKKNKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSINNETPGTRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVIYQYVDDLYVGSDLEIGQHRAKIEELRGHLLKWGFFTP
EEKHQKEPPFFWMGYELHPDKWTVQPIKLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006