<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-9228 9228-30911 Brazil 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54IL, L76V, I84V, L90M L10F, V11I, L33F, G73S I13V, G16A, E34EQ, I62V, L63P, A71V, I72L  
>9228-30911| codons 4-99
TLWQRPFITVKIAGQLKEALLDTGADDTVFQEMNLPGRWKPKIIGGIGGFLKVRQYDQVP
IEICGHKVLSTVVVGPTPVNVIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V, T215F K219Q Y188L   V60VI, K102KR, V118I, K122P, I135T, V179I, G196E, I202V, F214L, D237E, I244IM T69TNSY
>9228-30911| codons 38-246
CTEMEKEGKISKIGPENPYNTPIFAIKKKNSYRWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKRKKSVTVLDVGDAYFSIPLDPDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIIIYQYVDDLLVGSDLEIEQHRTKVEELRQHLLRWGLFTP
DQKHQKEPPFLWMGYELHPEKWTVQPMVL

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006