<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-9020 9020-30909 Brazil 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, I13V, G17E, M36MI, I62V, L63P, A71T, I93L  
>9020-30909| codons 4-99
TLWQRPIVTVKIGEQLKEALLDTGADDTVLEEINLPGRWKPKMIGGIGGFIKVRQYDQVP
IEICGHKTIGTVLVGPTPVNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
T69DN, K70KR   Y181C   V90I, K102Q, S162C, T165I, D177E, T200A, I202V, E203K, R211K, K223Q, L228R G152GE
>9020-30909| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFAIKKKDSNRWRKLVDFRELNKRTQDFWEIQLGIPHP
AGLKQKKSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSINNETPGIRYQYNVLPQEWKGSP
AIFQCSMIKILEPFRKQNPEIVICQYMDDLYVGSDLEIGQHRAKVKELRQHLLKWGFTTP
DKKHQQEPPFRWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006