<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-9018 9018-30909 Brazil 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I47IV, I54V, V82A, L90M F53L, G73S L10I, I13IV, I15V, G16A, K20I, L24LF, M36MI, K55R, I62IV, L63P, A71V, I72IL, N83NS  
>9018-30909| codons 4-99
TLWQRPIVTVKVAGQLIEALFDTGADDTVLEEINLPGRWKPKIVGGIGGLVRVRQYDQVP
IEICGHKVLSTVLVGPTPASIIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
Q151M A62V, V75I, F77L, F116Y, M184L, K219E K101E, Y181C V108I S68G, D123E, D177E, T200A, Q207K, R211T, V245E F87FS, Q182N, Y183T
>9018-30909| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFVIKKKDGTKWRKLIDLRELNKRTQDSWEVQLGIPHP
AGLEKKKSVTILDVGDAYYSVPLDKEFRKYTAFTIPSINNETPGIRYQYNVLPMGWKGSP
AIFQSSMTKILEPFRKQNPEIVICNTLDDLYVGSDLEIGQHRAKIEELRKHLLTWGFTTP
DEKHQKEPPFLWMGYELHPDKWTVQPIELP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006