<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-9016 9016-30908 Brazil 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A, L90M L33F, K43KPQT, G73T L10I, I13V, G16A, L24F, E34Q, R57K, Q61E, I62V, L63P, A71T, I72T, I93L  
>9016-30908| codons 4-99
TLWQRPIVTVKIAGQLKEALFDTGADDTVFQEMNLPGRWTPKMIGGIGGFVKVKQYDEVP
IEICGHKTTTTVLVGPTPANIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, M184V, L210W, T215Y       T39A, E44D, V118I, K122E, I135T, I142V, S162D, D177E, I178M, G196E, E203K, Q207E, H208Y, R211K, V245VM  
>9016-30908| codons 38-247
CAELEKDGKISKIGPENPYNTPVFAIKKKNSDKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSTNNETPGVRYQYNVLPQGWKGSP
AIFQDSMTKILEPFRKQNPEMVIYQYVDDLYVGSDLEIEQHRTKIKELREYLWKWGFYTP
DKKHQKEPPFLWMGYELHPDKWTVQPIMLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006