<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-9287 9287-30930 Brazil 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
L74LV A62V K101KE, Y181I   K122E, I135T, H221HY, V245I  
>9287-30930| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFVIKKKDSTKWRKVVDFRELNKRTQDFWEVQLGIPHP
AGLEKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVIIQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGFTTP
DKKYQKEPPFLWMGYELHPDKWTVQPIILP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A, L90M L10F L19I, N37S, R57K, L63P, A71V, V77I, L89I, I93L  
>9287-30930| codons 4-99
TLWQRPFVTIKIGGQIKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFVKVKQYDQIP
IEICGHKVIGTVLIGPTPANIIGRNIMTQLGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006