<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-9288 9288-30930 Brazil 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, M184MIV, L210W, T215Y K70KQ     E40V, K43Q, K101Q, V118I, D123E, I135T, D177E, V179VI, I202IT  
>9288-30930| codons 38-247
CTVLEQEGKISKIGPENPYNTPVFAIKKKNSTQWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLQKKKSVTVLDVGDAYFSIPLDKEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPEIIIYQYVDDLYVGSDLEIGQHRTKTEELRQHLWRWGFYTP
DKKHQKEPPFLWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, L76V, V82M, L90M L33F, Q58E, G73S, L89V L10IT, T12I, I15IV, G16A, N37D, R41K, D60E, I62V, L63P, A71V, I72K, I93L  
>9288-30930| codons 4-99
TLWQRPTVIIKVAGQLKEALLDTGADDTVFEEMDLPGKWKPKLIGGIGGFVKVREYEQVP
IEICGHKVKSTVVVGPTPMNIIGRNVMTQLGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006