<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-9282 9282-30929 Brazil 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, L76V, V82T, I84V, L90M K43T L10I, T12P, I15V, K20R, E35D, M36I, K55R, I62V, L63P, A71LV, I72T, I85V, Q92K, I93IL  
>9282-30929| codons 4-99
TLWQRPIVPIKVGGQLREALLDTGADDTVLEDINLPGRWTPKIIGGIGGFVRVRQYDQVP
IEICGHKVTGTVVVGPTPTNVVGRNLMTKLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, K70R, T215F K219Q Y188L   V106I, L109V, D121Y, K122E, I135T, Q174QK, D177E, V179I, V189I, G196E, I202V, D218E  
>9282-30929| codons 38-247
CTELEKEGKISKIGPENPYNTPVFAIKKKNSDRWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSITVVDVGDAYFSVPLYEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKKNPEIIIYQYMDDLLIGSDLEIEQHRTKVEELRQHLLRWGFFTP
EQKHQKEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006