<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-9279 9279-30925 Brazil 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, I84V, L90M L10F, Q58E, N88D I15V, G16A, L19P, K20I, A22V, E35D, M36I, N37Q, D60E, I62V, L63P, C67F, H69Q, K70E, A71V, I72T, I85V, T91S  
>9279-30925| codons 4-99
TLWQRPFVTIKVAGQPIEVLLDTGADDTVLEDIQLPGRWKPKIIGGIGGFVKVREYEQVP
IEIFGQEVTGTVLVGPTPVNVVGRDLMSQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
Y115F, Q151M, M184V A62V, K70T, V75I, F77L, F116Y   V108I T58N, S68G, T69TN, D121H, K122E, I135T, D177E, V245K I63IL
>9279-30925| codons 38-247
CTEMEKEGKISKIGPENPYNNPVFVLKKKDGNTWRKLIDLRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTILDVGDAFYSVPLHEDFRKYTAFTIPSTNNETPGIRYQYNVLPMGWKGSP
AIFQSSMTKILEPFRKQNPEIVIYQYVDDLYVGSDLEIGQHRTKIEELRQHLLRWGFTTP
DKKHQKEPPFLWMGYELHPDKWTVQPIKLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006