<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-9263 9263-30923 Brazil 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, I84V, L90M L10F, L33F, G73T L19I, K55R, R57K, I62IV, L63Q, I64V, I66V, C67F, H69CR, I72V, V77I, I93L  
>9263-30923| codons 4-99
TLWQRPFVTIKIGGQIKEALLDTGADDTVFEEMNLPGRWKPKIIGGIGGFVRVKQYDQVQ
VEVFGRKAVTTVLIGPTPVNVIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L210W, T215Y   Y188L, G190GA K101H K43Q, V60VI, V118VI, K122E, S162C, R172RK, D177E, V179I, R211K, L228H  
>9263-30923| codons 38-247
CTELEQEGKISKIGPENPYNTPIFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLHKKKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQCSMTKILEPFKKQNPEIIIYQYMDDLLVASDLEIGQHRTKIEELRQHLWKWGFYTP
DKKHQKEPPFHWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006