<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-9277 9277-30923 Brazil 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46L, I54V, V82A, I84V L24I, L33F, F53L, Q58E L10I, L19T, K20R, E34Q, E35D, M36I, N37ND, R41RK, L63P, I64V, V77I  
>9277-30923| codons 4-99
TLWQRPIVTIKIGGQTREALIDTGADDTIFQDIDLPGKWKPKLIGGIGGLVKVREYDQIP
VEICGHKAIGTVLIGPTPANVIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74V, M184V, L210W, T215Y D67G L100I, K103N   K43Q, E44EAD, S68G, T69E, V90VI, V118I, K122E, I135T, S162Y, V179I, I195L, T200A, R211Q  
>9277-30923| codons 38-247
CTELEQDGKISKIGPENPYNTPVFAIKKKGGEKWRKVVDFRELNKRTQDFWEIQLGIPHP
AGIKKNKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQYSMTKILEPFRKQNPDIIIYQYVDDLYVGSDLELGQHRAKIEELRQHLWQWGFYTP
DKKHQKEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006