<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-9261 9261-30922 Brazil 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46L, I47V, G48V, I54M, V82A L24I, L33LF L10I, I15IV, G16Q, K20KT, E34Q, P39S, R41RK, I64V, I72IV, T74S, V77I  
>9261-30922| codons 4-99
TLWQRPIVTIKVQGQLTEALIDTGADDTIFQEMNLSGKWKPKLVVGIGGFMKVRQYDQIL
VEICGHKAVGSVLIGPTPANIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, M184V, L210W, T215Y       I135T, K166N, E169D, G196E, Q197K, I202V, V245E  
>9261-30922| codons 38-247
CTELEKEGKISKIGPENPYNTPVFAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTNILDPFRKQNPDIVIYQYVDDLYVGSDLEIEKHRTKVEELRQHLWRWGFYTP
DKKHQKEPPFLWMGYELHPDKWTVQPIELP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006