<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-9262 9262-30922 Brazil 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67DN, K70R K219Q Y181C, G190GA   V90VI, D121Y, K122E, I135T, V179VI, I202V, R211K, F214L, L228LR  
>9262-30922| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFAIKKKNSTRWRKLVDFRELNKRTQDFWEIQLGIPHP
AGLKKKKSVTVLDVGDAYFSVPLYEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIIICQYMDDLYVASDLEIGQHRTKVEELRQHLLKWGLTTP
DQKHQKEPPFRWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I47IV, I54V, L90M G73T L10R, I13M, K14R, L19I, K20I, E35D, M36I, I62V, L63P, I64V, I93L, C95F  
>9262-30922| codons 4-99
TLWQRPRVTMRIGGQIIEALLDTGADDTVLEDINLPGRWKPKIVGGIGGFVKVRQYDQVP
VEICGHKAITTVLVGPTPVNIIGRNLMTQLGFTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006