<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-9259 9259-30918 Brazil 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, L74LI, M184V, L210W, T215Y   Y188L A98G T39TA, K43E, V106I, V118I, K122E, V179VI, I202V, R211K, E224D, D237DE, V245M  
>9259-30918| codons 38-247
CAELEEEGKISKIGPENPYNTPVFAIKKKNSDKWRKIVDFRELNKRTQDFWEVQLGIPHP
GGLKKKKSITVLDVGDAYFSIPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIIIYQYVDDLLVGSDLEIGQHRTKVEELRQHLWKWGFYTP
DKKHQKDPPFLWMGYELHPEKWTVQPIMLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, V82A, I84V L24I, L33F, K43T, G73S L10I, I13IV, K20R, E35D, M36V, N37D, K55R, L63P, A71V, T91S  
>9259-30918| codons 4-99
TLWQRPIVTVKIGGQLREALIDTGADDTVFEDVDLPGRWTPKLIGGIGGFVRVRQYDQIP
IEICGHKVISTVLVGPTPANVIGRNLLSQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006