<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-9256 9256-30916 Brazil 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32VI, M46MI, I47IV, I54V, L90M L33LI, K43KT, F53FL, T74TP L10IV, I15V, K20R, E35D, M36I, N37D, I62IV, L63P, I64IL, A71AV, V82X, I85IV, L89LM  
>9256-30916| codons 4-99
TLWQRPVVTIKVGGQLREALLDTGADDTIIEDIDLPGRWTPKIVGGIGGLVKVRQYDQVP
LEICGHKVIGPVLVGPTPXNIVGRNMMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, M184MV, L210W, T215Y       T39E, E44D, V60I, V118VI, D123E, I135T, K166R, D177DE, I178M, E203ED, H208HY, R211K, L228LH  
>9256-30916| codons 38-246
CEELEKDGKISKIGPENPYNTPIFAIKKKNSDKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSIPLDKEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTRILEPFRKQNPEMVIYQYVDDLYVGSDLEIGQHRTKIDELRQYLWKWGFYTP
DKKHQKEPPFHWMGYELHPDKWTVQPIVL

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006