<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-9252 9252-30911 Brazil 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I47V, L76V L10F, L23LI T12K, L19I, R41K, I62V, L63P, A71T, I72E  
>9252-30911| codons 4-99
TLWQRPFVKIKIGGQIKEAILDTGADDTVLEEMNLPGKWKPKIVGGIGGFIKVRQYDQVP
IEICGHKTEGTVVVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184MV, T215Y A62AV K103N   E44ED, K65KE, K122KE, I135T, R172RK, Q197QL, I202V, V245T  
>9252-30911| codons 38-247
CTEMEKDGKISKIGPENPYNTPVFVIKEKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFKKQNPDIVIYQYVDDLYVGSDLEIGLHRTKVEELRQHLLRWGFYTP
DKKHQKEPPFLWMGYELHPDKWTVQPITLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006