<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-9255 9255-30911 Brazil 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I47V, I54L, I84V, L90M L10F, L33F, K43KT, T74P V11L, I13V, E34Q, I62V, L63P, H69R, A71V, I72V, V77VI, I93L  
>9255-30911| codons 4-99
TLWQRPFLTVKIGGQLKEALLDTGADDTVFQEMNLPGRWTPKIVGGIGGFLKVRQYDQVP
IEICGRKVVGPVLIGPTPVNVIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, M184MI, L210W, T215F A62V, K219W K103N, Y181C, G190A   K65KE, K101Q, K122E, I202V, Q207E, H208Y, R211K, I244IM  
>9255-30911| codons 38-246
CTEMEKEGKISKIGPENPYNTPVFVIKEKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLQKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVICQYIDDLYVASDLEIGQHRTKVEELREYLWKWGFFTP
DWKHQKEPPFLWMGYELHPDKWTVQPMVL

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006