<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-9253 9253-30909 Brazil 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46FL, G48V, I54V, V82A, I84IV, L90M Q58QE L10I, I13IM, M36I, N37D, I62V, L63P, A71V, I72IT, I93L  
>9253-30909| codons 4-99
TLWQRPIVTMKIGGQLKEALLDTGADDTVLEEIDLPGRWKPKLIVGIGGFVKVREYDQVP
IEICGHKVTGTVLVGPTPANVIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, M184V, L210W, T215Y F77FL, K219KEGR     K102R, V118I, K122E, I178M, V189I, Q207E, D218DE I167IM
>9253-30909| codons 38-247
CTELEKEGKISKIGPENPYNTPVFAIKKKNSTKWRKLVDLRELNKRTQDFWEVQLGIPHP
AGLKRKKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKMLEPFRKQNPDMVIYQYVDDLYIGSDLEIGQHRTKIEELREHLWRWGFYTP
ERKHQKEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006