<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-9250 9250-30908 Brazil 2003 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, V82A V11VI, L24I, L33F, T74P L10I, I13V, G17E, L19I, K20R, E35D, M36I, R41K, R57K, Q61DN, I62V, L63T, E65D, I72T, L89M  
>9250-30908| codons 4-99
TLWQRPIITVKIGEQIREALIDTGADDTVFEDINLPGKWKPKLIGGIGGFVKVKQYDNVT
IDICGHKATGPVLVGPTPANIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, L74IV, V75VAIT, M184V, T215F K219E L100I, K103N   T69N, K122E, I135V, E169D, P170L, K173A, Q174K, D177N, G196E, Q207E, R211K, L228H, V245Q  
>9250-30908| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFAIKKKNSNRWRKVTDFRELNKRTQDFWEVQLGIPHP
AGIKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILDLFRAKNPNIVIYQYVDDLYVGSDLEIEQHRTKIEELREHLLKWGFFTP
DEKHQKEPPFHWMGYELHPDKWTVQPIQLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006