<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-9083 9083-30904 Brazil 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54AV, V82A, I84IV L24I L10I, T12S, I15V, G16GA, L19Q, K20IM, E35D, M36I, N37ND, K43KR, Q61QH, L63P, I64V, A71V, I72V, Q92K  
>9083-30904| codons 4-99
TLWQRPIVSIKVAGQQMEALIDTGADDTVLEDIDLPGRWRPKLIGGIGGFVKVRQYDHIP
VEICGHKVVGTVLVGPTPANVIGRNLLTKIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, V75M, M184V, L210W, T215Y     Y181YF K43E, K122E, D123K, I135T, T200I, I202IV, H208HY, R211K  
>9083-30904| codons 38-247
CTEMEEEGKISKIGPENPYNTPVFAIKKKNSTKWRKLMDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSVPLDEKFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVIFQYVDDLYVGSDLEIGQHRIKVEELRQYLWKWGFYTP
DKKHQKEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006