<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-9079 9079-30903 Brazil 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54M, I84V, L90M L10F, G73T Q18H, K20I, E34Q, M36I, N37ND, R41K, G51A, K55R, D60E, L63P, I64V, A71V, P79AD, I85V  
>9079-30903| codons 4-99
TLWQRPFVTIKIGGHLIEALLDTGADDTVLQEIDLPGKWKPKIIGGIAGFMRVRQYEQIP
VEICGHKVITTVLVGDTPVNVVGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, K70KR, L74IV, M184MV, T215F D67G, V75M, K219Q L100I, K103N   T39A, K43E, T69N, D123E, I135T, D177E, G196E, I202V, D218E, L228H, P243T S68SDGN, L109LP
>9079-30903| codons 38-247
CAELEEEGKISKIGPENPYNTPVFAIKKKGNNRWRKVMDFRELNKRTQDFWEVQLGIPHP
AGIKKNKSVTVPDVGDAYFSVPLDKEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPEIVIYQYVDDLYVGSDLEIEQHRTKVEELRQHLLRWGFFTP
EQKHQKEPPFHWMGYELHPDKWTVQTIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006