<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-9078 9078-30903 Brazil 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70KR, L74V, M184V K219E K103S, G190A   K102Q, V106L, K122E, I135T, K173Q, D177E, R211K, I244IV, V245A  
>9078-30903| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFAIKKKNSTRWRKVVDFRELNKRTQDFWEVQLGIPHP
AGLKQSKSLTVLDVGDAYFSVPLDEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRQQNPEIVIYQYVDDLYVASDLEIGQHRTKIEELRQHLLKWGFTTP
DEKHQKEPPFLWMGYELHPDKWTVQPVALP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48V, I50V, I54A, V82A L24I, L33F, Q58E L10I, I13V, E35D, M36L, N37D, I62V, I64V  
>9078-30903| codons 4-99
TLWQRPIVTVKIGGQLKEALIDTGADDTVFEDLDLPGRWKPKMIVGVGGFAKVREYDQVL
VEICGHKAIGTVLVGPTPANIIGRNLLTQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006