<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-9080 9080-30903 Brazil 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48V, I50V, I54V, V82A L33F, K43IT L10I, K20R, E35D, M36I, N37D, I62V, L63P, I64V, L89LIM  
>9080-30903| codons 4-99
TLWQRPIVTIKIGGQLREALLDTGADDTVFEDIDLPGRWTPKMIVGVGGFVKVRQYDQVP
VEICGHKAIGTVLVGPTPANIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, V75M, L210W, T215Y K219R K103N, G190A V108I K43E, E44A, V90I, V118I, K122E, R172RK, I178M, T200K, E203D, R211K, H221Y, V245R  
>9080-30903| codons 38-247
CTELEEAGKISKIGPENPYNTPVFAIKKKNSDKWRKLMDFRELNKRTQDFWEIQLGIPHP
AGLKKNKSVTILDVGDAYFSIPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFKKQNPDMVIYQYMDDLYVASDLEIGQHRKKIDELRQHLWKWGFYTP
DRKYQKEPPFLWMGYELHPDKWTVQPIRLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006