<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-9075 9075-30902 Brazil 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, L76V, V82A, L90M K43T L10I, I15IV, G16A, K20R, E35D, M36I, N37D, K55KR, R57RK, D60E, I62V, L63P, A71V, I72T, I93L  
>9075-30902| codons 4-99
TLWQRPIVTIKVAGQLREALLDTGADDTVLEDIDLPGRWTPKIIGGIGGFVRVKQYEQVP
IEICGHKVTGTVVVGPTPANIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74LI, M184V, L210LW, T215Y V75VALS     T39TA, K43E, E44A, S48T, S68SG, V118VI, K122E, D123DN, I142IV, S162SDGN, K166R, V179VI, E203ED, H208HY, R211K H221HCRY
>9075-30902| codons 38-247
CAELEEAGKITKIGPENPYNTPVFAIKKKDGTKWRKISDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSIPLDENFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSP
AIFQNSMTRILEPFRKQNPDIIIYQYVDDLYVGSDLEIGQHRTKIDELRQYLWKWGFYTP
DKKYQKEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006