<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-9341 9341-30930 Brazil 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, V82A L24I, L33F L10I, I13IV, I62IV, L63D, E65D, A71V, I72K, V77I  
>9341-30930| codons 4-99
TLWQRPIVTVKIGGQLKEALIDTGADDTVFEEMNLPGRWKPKLIGGIGGFVKVRQYDQVD
IDICGHKVKGTVLIGPTPANIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V K219KE     D121H, K122E, I135T, I142V, K166R, D177E, G196E, T200A, E203K, Q207E  
>9341-30930| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSVPLHEDFRKYTAFTIPSTNNETPGVRYQYNVLPQGWKGSP
AIFQSSMTRILEPFRKQNPEIVIYQYVDDLYVGSDLEIEQHRAKIKELREHLLRWGFTTP
DEKHQKEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006