<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-9342 9342-30930 Brazil 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82A   L10I, L24M, R41K, L63P, A71V, T74S, V77I, I93L  
>9342-30930| codons 4-99
TLWQRPIVTIKIGGQLKEALMDTGADDTVLEEMNLPGKWKPKIIGGIGGFVKVRQYDQIP
IEICGHKVIGSVLIGPTPANIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, M184V, L210W, T215Y   Y188L   T39A, K43KQ, E44D, V118I, K122E, D123N, D177E, V179I, V189VI, T200TA, H208Y, R211K, E224ED, V245K  
>9342-30930| codons 38-247
CAELEQDGKISKIGPENPYNTPVFAIKKKNSDKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSIPLDENFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPEIIIYQYVDDLLIGSDLEIGQHRAKIEELRQYLWKWGFYTP
DKKHQKDPPFLWMGYELHPDKWTVQPIKLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006