<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-9303 9303-30922 Brazil 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L210W, T215Y A62V, V75T     K43E, A98S, K102Q, S162A, G196E, V245M  
>9303-30922| codons 38-247
CTELEEEGKISKIGPENPYNTPVFVIKKKDSTKWRKLTDFRELNKRTQDFWEVQLGIPHP
SGLKQKKSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQASMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIEQHRTKIEELRQHLWRWGFYTP
DKKHQKEPPFLWMGYELHPDKWTVQPIMLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N, M46I, I50V L10F, N88D K20I, E35G, M36I, Q61E, L63P  
>9303-30922| codons 4-99
TLWQRPFVTIKIGGQLIEALLDTGADNTVLEGINLPGRWKPKIIGGVGGFIKVRQYDEIP
IEICGHKAIGTVLVGPTPVNIIGRDLLTQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006