<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-9302 9302-30918 Brazil 2003 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A, L90M L10F, G73GS, L89IMV I15V, K20I, E35D, M36I, N37K, R41N, Q61H, L63P, H69K, A71V, I85V, I93L  
>9302-30918| codons 4-99
TLWQRPFVTIKVGGQLIEALLDTGADDTVLEDIKLPGNWKPKMIGGIGGFVKVRQYDHIP
IEICGKKVISTVLVGPTPANIVGRNVMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70KR, M184V, T215F K219Q K103N K238N T39D, V60VI, K122E, D123S, I135T, K173A, D177E, T200A, I202V, Q207E, R211K, V245Q  
>9302-30918| codons 38-247
CDELEKEGKISKIGPENPYNTPIFAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKNKSVTVLDVGDAYFSVPLDESFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRAQNPEIVIYQYVDDLYVGSDLEIGQHRAKVEELREHLLKWGFFTP
DQKHQKEPPFLWMGYELHPDNWTVQPIQLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006