<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-9297 9297-30916 Brazil 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I47IV, I54V, V82ST, L90M L10F, K43KT, G73S I15V, K20I, E35D, M36I, I62V, L63P, A71V, I85V  
>9297-30916| codons 4-99
TLWQRPFVTIKVGGQLIEALLDTGADDTVLEDINLPGRWTPKIVGGIGGFVKVRQYDQVP
IEICGHKVISTVLVGPTPTNIVGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74V, M184V, L210W, T215Y K219R V106A, G190A F227L K43Q, E44D, K101Q, S105T, V118I, K122E, R172K, H208Y, H221Y, K223Q  
>9297-30916| codons 38-247
CTELEQDGKISKIGPENPYNTPVFAIKKKNSTKWRKVVDFRELNKRTQDFWEVQLGIPHP
AGLQKKKTATVLDVGDAYFSIPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFKKQNPDIVIYQYVDDLYVASDLEIGQHRTKIEELRQYLWRWGFYTP
DRKYQQEPPLLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006