<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-9203 9203-30916 Brazil 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82A L24I, L33F, G73S W6WL, L10V, G16GA, E35D, M36IL, N37DE, K55R, I62V, L63P, A71V, I72IMT, I93L  
>9203-30916| codons 4-99
TLLQRPVVTIKIAGQLKEALIDTGADDTVFEDLELPGRWKPKIIGGIGGFVRVRQYDQVP
IEICGHKVTSTVLVGPTPANIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
Y115F, Q151M, M184V A62V, V75I, F77L, F116Y     S68G, T69X, D123E, I178IM, H208HY  
>9203-30916| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFVIKKKDGXKWRKLIDLRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAFYSVPLDKEFRKYTAFTIPSINNETPGIRYQYNVLPMGWKGSP
AIFQSSMTKILEPFRKQNPDMVIYQYVDDLYVGSDLEIGQHRTKIEELRQYLLRWGFTTP
DKKHQKEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006