<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-9200 9200-30911 Brazil 2003 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46ML, V82A, L90M   L10IV, I15V, K20R, E35D, M36I, R41K, R57K, Q61N, L63P, I93L  
>9200-30911| codons 4-99
TLWQRPVVTIKVGGQLREALLDTGADDTVLEDINLPGKWKPKLIGGIGGFIKVKQYDNIP
IEICGHKAIGTVLVGPTPANIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V, T215Y   K101P, K103N   K49R, K64R, K104KR, K122KE, I135V, S162Y, K166KE, K173A, Q174K, D177E, V179VI, T200A, R211K, V245Q  
>9200-30911| codons 38-247
CTEMEKEGKISRIGPENPYNTPVFAIRKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLPKNRSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSP
AIFQYSMTEILEPFRAKNPEIIIYQYVDDLYVGSDLEIGQHRAKIEELRQHLLKWGFYTP
DKKHQKEPPFLWMGYELHPDKWTVQPIQLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006