<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-9198 9198-30910 Brazil 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82AS L24I, L33LF, F53FL, Q58QE L10I, K20R, E35D, M36I, R41K, D60E, L63P, I64V, A71V, I93L  
>9198-30910| codons 4-99
TLWQRPIVTIKIGGQLREALIDTGADDTVFEDINLPGKWKPKMIGGIGGLVKVREYEQIP
VEICGHKVIGTVLVGPTPSNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, K70R, M184V D67G, K219Q     E42EG, K122E, D123E, T200V, Q207A, R211K, V245K T69Y
>9198-30910| codons 38-247
CTELGKEGKISKIGPENPYNTPVFAIKKKGSYRWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSVPLDEEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVIYQYVDDLYVGSDLEIGQHRVKIEELRAHLLKWGFTTP
DQKHQKEPPFLWMGYELHPDKWTVQPIKLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006