<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-9197 9197-30910 Brazil 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82A L24I L10I, T12P, K14GR, K55R, R57K, L63P, G68D, A71V, I93L  
>9197-30910| codons 4-99
TLWQRPIVPIRIGGQLKEALIDTGADDTVLEEMNLPGRWKPKIIGGIGGFVRVKQYDQIP
IEICDHKVIGTVLVGPTPANIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V, T215F A62V     V118I, K122E, I135T, K173R, V179I, R211S, F214L, Q242H, P243H, L246M F171FV
>9197-30910| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFVIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPVRRQNPDIIIYQYVDDLYVGSDLEIGQHRTKIEELRQHLLSWGLFTP
DKKHQKEPPFLWMGYELHPDKWTVHHIVMP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006