<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-9199 9199-30910 Brazil 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, V82A, L90M G73S L10I, I15V, G16A, K20M, L24F, E35D, M36I, R41K, K55R, I62V, L63P, A71V, I72L  
>9199-30910| codons 4-99
TLWQRPIVTIKVAGQLMEALFDTGADDTVLEDINLPGKWKPKLIGGIGGFVRVRQYDQVP
IEICGHKVLSTVLVGPTPANIIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, M184I, L210W T215C, K219Q K103N V108I T39A, V118I, D123N, I135T, V179I, I202V, H208Y, R211K, D218E  
>9199-30910| codons 38-247
CAELEKEGKISKIGPENPYNTPVFAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKNKSVTILDVGDAYFSIPLDKNFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIIIYQYIDDLYVGSDLEIGQHRTKVEELRQYLWKWGFCTP
EQKHQKEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006