<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-9194 9194-30903 Brazil 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, I84V, L90M L10F, L33LF, G73S K20KR, E35D, M36I, I62V, L63P, A71V, I93L  
>9194-30903| codons 4-99
TLWQRPFVTIKIGGQLREALLDTGADDTVFEDINLPGRWKPKIIGGIGGFVKVRQYDQVP
IEICGHKVISTVLVGPTPVNVIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L210W, T215Y K219R   V108VI T39A, E44D, W88WC, K104N, V118I, K122E, S162D, E203D, Q207E, H208Y, R211K, H221Y D192Y
>9194-30903| codons 38-240
CAELEKDGKISKIGPENPYNTPVFAIKKKNSTKWRKLVDFRELNKRTQDFCEVQLGIPHP
AGLKKKNSVTILDVGDAYFSIPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQDSMTKILEPFRKQNPDIVIYQYMDDLYVGSYLEIGQHRTKIDELREYLWKWGFYTP
DRKYQKEPPFLWMGYELHPDKWT

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006