<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-9193 9193-30903 Brazil 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, L74V, M184V, L210W, T215Y K219E L100I, K103N   T39A, E44D, V118I, K122E, D177G, H208Y, R211K, D218E, L228H  
>9193-30903| codons 38-247
CAELEKDGKISKIGPENPYNTPVFAIKKKNSTRWRKVVDFRELNKRTQDFWEVQLGIPHP
AGIKKNKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPGIVIYQYVDDLYVGSDLEIGQHRTKIEELRQYLWKWGFYTP
EEKHQKEPPFHWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I47V, I54V, I84V, L90M L10F, V11I, G73ST T12TP, I13V, I15V, K20I, M36I, I62V, L63P, C67F, A71V, P79A, I93L  
>9193-30903| codons 4-99
TLWQRPFIPVKVGGQLIEALLDTGADDTVLEEINLPGRWKPKIVGGIGGFVKVRQYDQVP
IEIFGHKVITTVLVGATPVNVIGRNLMTQLGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006