<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-9196 9196-30903 Brazil 2003 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I50V, I54V, V82A L33I, L76M, N83D L10V, T12E, I13V, K20R, E35D, M36I, R41K, R57K, Q61N, I62V, L63P, I72T, T74S, L89I  
>9196-30903| codons 4-99
TLWQRPVVEVKIGGQLREALLDTGADDTVIEDINLPGKWKPKIIGGVGGFVKVKQYDNVP
IEICGHKATGSVMVGPTPADIIGRNILTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, T215Y       T39A, V118I, K122E, D123E, I135T, E169ED, F171FL, K173T, Q174K, T200A, E203D, Q207E, R211K, F214L, V245Q  
>9196-30903| codons 38-247
CAELEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSIPLDEEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILDPLRTKNPDIVIYQYVDDLYVGSDLEIGQHRAKIDELREHLLKWGLYTP
DKKHQKEPPFLWMGYELHPDKWTVQPIQLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006