<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-9307 9307-30918 Brazil 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N N88D L10V, I13IV, I15V, K20T, E35D, M36I, R41K, Q61DN, L63S, E65D, A71AV, I72IT  
>9307-30918| codons 4-99
TLWQRPVVTVKVGGQLTEALLDTGADNTVLEDINLPGKWKPKMIGGIGGFIKVRQYDNIS
IDICGHKVTGTVLVGPTPVNIIGRDLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70R, M184V K219Q K103N   T69N, A98AS, K101KR, I135ILM, L228H  
>9307-30918| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFAIKKKDSNRWRKLVDFRELNKRTQDFWEVQLGIPHP
SGLRKNKSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSMNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVIYQYVDDLYVGSDLEIGQHRTKIEELRQHLLRWGFTTP
DQKHQKEPPFHWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006