<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-9179 9179-30916 Brazil 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74I, M184V, L210W, T215Y V75S Y181C V108I T39TA, S68G, V90I, K122E, I135T, M164MI, Q207N, R211K, H221Y  
>9179-30916| codons 38-247
CAELEKEGKISKIGPENPYNTPVFAIKKKDGTKWRKISDFRELNKRTQDFWEIQLGIPHP
AGLKKKKSVTILDVGDAYFSVPLDEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQSSITKILEPFRKQNPDIVICQYVDDLYVGSDLEIGQHRTKIEELRNHLWKWGFYTP
DKKYQKEPPFLWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54L, I84V, L90M   L10I, K20R, E35D, M36I, N37ND, I62V, L63P, A71I, P79PS, I85V, Q92K, I93L  
>9179-30916| codons 4-99
TLWQRPIVTIKIGGQLREALLDTGADDTVLEDIDLPGRWKPKLIGGIGGFLKVRQYDQVP
IEICGHKIIGTVLVGSTPVNVVGRNLMTKLGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006