<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-9305 9305-30916 Brazil 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54AV, V82A, I84IV, L90M Q58E L10V, I15V, K20KR, M36MI, R41K, D60E, I62V, L63P, A71V, I93L  
>9305-30916| codons 4-99
TLWQRPVVTIKVGGQLREALLDTGADDTVLEEINLPGKWKPKLIGGIGGFVKVREYEQVP
IEICGHKVIGTVLVGPTPANVIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
L210W, T215Y   K103N, Y181C, G190A   K49KR, I135T, R211K, V245K  
>9305-30916| codons 39-247
TEMEKEGKISRIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPA
GLKKNKSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPA
IFQSSMTKILEPFRKQNPDIVICQYMDDLYVASDLEIGQHRTKIEELRQHLWKWGFYTPD
KKHQKEPPFLWMGYELHPDKWTVQPIKLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006