<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-9178 9178-30911 Brazil 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, V82A L24I L10I, K20R, E35D, M36I, N37E, K55R, R57K, L63P, A71V  
>9178-30911| codons 4-99
TLWQRPIVTIKIGGQLREALIDTGADDTVLEDIELPGRWKPKLIGGIGGFVRVKQYDQIP
IEICGHKVIGTVLVGPTPANIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L210W, T215Y       K82KR, V118I, K122E, I135T, I142IV, T200TA, I202V, E204X, H208HY, R211K, V245T  
>9178-30911| codons 38-247
CTELEKEGKISKIGPENPYNTPVFAIKKKNSTKWRKLVDFRELNRRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSTNNETPGVRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRAKVEXLRQYLWKWGFYTP
DKKHQKEPPFLWMGYELHPDKWTVQPITLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006