<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-9173 9173-30909 Brazil 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, M184V, L210W, T215Y V75M, K219KN K101P, K103N   K43N, E44D, I94L, D123E, I135L, K166Q, D177E, G196E, T200TA, H221HY  
>9173-30909| codons 38-247
CTELENDGKISKIGPENPYNTPVFAIKKKNSTKWRKLMDFRELNKRTQDFWEVQLGLPHP
AGLPKNKSVTVLDVGDAYFSVPLDKEFRKYTAFTIPSLNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTQILEPFRKQNPEIVIYQYVDDLYVGSDLEIEQHRAKIEELRQHLWRWGFYTP
DNKYQKEPPFLWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54M, V82A, L90M V11I, L33F, G73T, L89V L10V, I13V, N37D, K55R, L63P, A71V, I72E, I93L  
>9173-30909| codons 4-99
TLWQRPVITVKIGGQLKEALLDTGADDTVFEEMDLPGRWKPKLIGGIGGFMRVRQYDQIP
IEICGHKVETTVLVGPTPANIIGRNVMTQLGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006