<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-9174 9174-30909 Brazil 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46MI, I54V, V82M L24I, Q58E, L89V W6S, L10I, I15V, E35D, M36I, N37D, R41K, I62V, L63P, Q92R  
>9174-30909| codons 4-99
TLSQRPIVTIKVGGQLKEALIDTGADDTVLEDIDLPGKWKPKIIGGIGGFVKVREYDQVP
IEICGHKAIGTVLVGPTPMNIIGRNVLTRIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, L74I, V75T, M184V, L210W, T215Y A62AV     V118I, K122E, D123NS, I135T, S162C, G196E, K201M, E203K, H208Y, R211K, F214L, K223T, E224D, V245E  
>9174-30909| codons 38-246
CTELEKEGKISKIGPENPYNTPVFVIKKKNSDKWRKITDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSIPLDESFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQCSMTKILEPFRKQNPDIVIYQYVDDLYVGSDLEIEQHRTMIKELRQYLWKWGLYTP
DKKHQTDPPFLWMGYELHPDKWTVQPIEL

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006