<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-9172 9172-30904 Brazil 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, G48Q, I54S, V82F, L90M K43T, F53L L10I, K20R, E35D, M36IV, N37S, R41RK, D60E, Q61E, I62V, L63P, H69HY, A71V, I72V, V77I, I93L  
>9172-30904| codons 4-99
TLWQRPIVTIKIGGQLREALLDTGADDTVLEDVSLPGKWTPKIIQGIGGLSKVRQYEEVP
IEICGYKVVGTVLIGPTPFNIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74V, M184V, L210W, T215Y K219N     T39A, K43E, K64R, A98S, K102Q, V118I, K122E, I135T, I142T, Q197E, T200A, H208Y, R211K, L228H, V245M L80LP
>9172-30904| codons 38-247
CAELEEEGKISKIGPENPYNTPVFAIRKKNSTKWRKVVDFREPNKRTQDFWEVQLGIPHP
SGLKQKKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSTNNETPGTRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVIYQYVDDLYVGSDLEIGEHRAKIEELRQYLWKWGFYTP
DNKHQKEPPFHWMGYELHPDKWTVQPIMLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006