<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-9171 9171-30904 Brazil 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, G48A, I54V, V82A, L90LM K43T, G73GS L10I, K14R, I15IV, K20R, E35D, M36I, N37NS, R41RK, I62V, L63AP, A71V, I72IT, I93L  
>9171-30904| codons 4-99
TLWQRPIVTIRVGGQLREALLDTGADDTVLEDISLPGKWTPKLIAGIGGFVKVRQYDQVP
IEICGHKVTSTVLVGPTPANIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, M184V, L210W, T215Y   K103KN   T39TA, K43E, W88C, D123E, Q145V, I178L, V179VI, G196E, E203D, V245E  
>9171-30904| codons 38-247
CAELEEEGKISKIGPENPYNTPVFAIKKKNSTKWRKLVDFRELNKRTQDFCEVQLGIPHP
AGLKKNKSVTVLDVGDAYFSVPLDKEFRKYTAFTIPSINNETPGIRYVYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDLIIYQYVDDLYVGSDLEIEQHRTKIDELRQHLWRWGFYTP
DKKHQKEPPFLWMGYELHPDKWTVQPIELP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006