<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-9332 9332-30929 Brazil 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, M184V, L210W, T215CHRY K219E K103S, G190A   T39A, V60VI, T69N, D123E, S162D, K166R, D177E, V179I, R211K, V245M  
>9332-30929| codons 38-247
CAELEKEGKISKIGPENPYNTPIFAIKKKNSNRWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKSKSVTVLDVGDAYFSVPLDKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQDSMTRILEPFRKQNPEIIIYQYVDDLYVASDLEIGQHRTKIEELRQHLWKWGFYTP
DEKHQKEPPFLWMGYELHPDKWTVQPIMLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82A, I84V, L90M L33F, F53L, Q58E, G73S L10I, I13V, K20R, E34AT, E35D, M36I, I62V, L63P, A71V  
>9332-30929| codons 5-99
LWQRPIVTVKIGGQLREALLDTGADDTVFTDINLPGRWKPKIIGGIGGLVKVREYDQVPI
EICGHKVISTVLVGPTPANVIGRNLMTQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006