<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-9330 9330-30929 Brazil 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54M, L76V, V82A L24I, L33F, K43T L10I, T12K, I13V, R41K, K55KR, I62V, L63P, A71V  
>9330-30929| codons 4-99
TLWQRPIVKVKIGGQLKEALIDTGADDTVFEEMNLPGKWTPKIIGGIGGFMRVRQYDQVP
IEICGHKVIGTVVVGPTPANIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, L74I, M184V, T215F K219Q K101HPQ, Y181C, G190A A98AG, V108VI T39A, T69N, K103KR, R211K, D218E, L228H  
>9330-30929| codons 38-247
CAELEKEGKISKIGPENPYNTPVFAIKKKNSNRWRKIVDFRELNKRTQDFWEVQLGIPHP
GGLQKRKSVTILDVGDAYFSVPLDKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVICQYVDDLYVASDLEIGQHRTKIEELRQHLLKWGFFTP
EQKHQKEPPFHWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006