<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-9247 9247-30922 Brazil 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, M184MIV, T215F A62V, V75T, K219E K101AEPQ, Y181C, G190A V108VI T69TN, K122E, I135T, Q197K, T200A, D218E, L228H, V245E  
>9247-30922| codons 38-247
CTELEKEGKISKIGPENPYNTPVFVIKKKNSNRWRKLTDFRELNKRTQDFWEVQLGIPHP
AGLQKKKSVTILDVGDAYFSVPLDEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVICQYVDDLYVASDLEIGKHRAKIEELRQHLLRWGFFTP
EEKHQKEPPFHWMGYELHPDKWTVQPIELP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, I84V, L90M G73S I13V, I15V, K20MT, I62V, L63P, H69QR, A71V, I72M, I93L  
>9247-30922| codons 4-99
TLWQRPLVTVKVGGQLTEALLDTGADDTVLEEMNLPGRWKPKIIGGIGGFVKVRQYDQVP
IEICGRKVMSTVLVGPTPVNVIGRNLMTQLGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006