<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-9242 9242-30922 Brazil 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I50V, I54V, V82F, L90M L89V L10I, T12K, I15V, L19I, K20I, M36I, R41K, L63LP, A71I, I85V, I93L  
>9242-30922| codons 4-99
TLWQRPIVKIKVGGQIIEALLDTGADDTVLEEINLPGKWKPKIIGGVGGFVKVRQYDQIP
IEICGHKIIGTVLVGPTPFNIVGRNVMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, L210W, T215Y       T39TA, E44D, S68G, V118VI, K122E, I135T, K166R, T200TA, V245T  
>9242-30922| codons 38-247
CAELEKDGKISKIGPENPYNTPVFAIKKKDGTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTRILEPFRKQNPDIVIYQYVDDLYVGSDLEIGQHRAKIEELRQHLWRWGFYTP
DKKHQKEPPFLWMGYELHPDKWTVQPITLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006