<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-9245 9245-30922 Brazil 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46MI, I54LV, I84V, L90M L33F, K43T L10I, I13V, K20R, E35D, M36I, D60E, I62IV, L63P, H69Q, A71V  
>9245-30922| codons 4-99
TLWQRPIVTVKIGGQLREALLDTGADDTIFEDINLPGRWTPKIIGGIGGFVKVRQYEQVP
IEICGQKVIGTVLVGPTPVNVIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, T69TADN, L210W, T215Y V75VI Y181YC, G190GA   W88C, D123E, I135IT, R172RK, D177E, R211K, V245M D76DA
>9245-30922| codons 38-247
CTELEKEGKISKIGPENPYNTPVFAIKKKDSNKWRKLIAFRELNKRTQDFCEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSVPLDKEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFKKQNPEIVICQYMDDLYVASDLEIGQHRTKIEELRQHLWKWGFYTP
DKKHQKEPPFLWMGYELHPDKWTVQPIMLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006